Gene Mb2559c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc39. contains pin domain. |
| Comments | Mb2559c, -, len: 139 aa. Equivalent to Rv2530c,len: 139 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 139 aa overlap). Conserved hypothetical protein, highly similar to two HYPOTHETICAL PROTEINS from Mycobacterium tuberculosis (strains H37Rv and CDC1551): O53219|Rv2494|MTV008.50 (141 aa), FASTA scores: opt: 380, E(): 3.6e-19, (48.0% identity in 125 aa overlap); and O53372|Rv3320c|MTV016.20c (142 aa), FASTA scores: opt: 286, E(): 9.3e-13, (41.35% identity in 133 aa overlap); and similar to others e.g. O07760|Rv0617|MTCY19H5.04c (133 aa), FASTA scores: opt: 158, E(): 0.00048, (39.55% identity in 129 aa overlap). Also some similarity with CAC48798|SMB20412 CONSERVED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) plasmid pSymB (54 aa), FASTA scores: opt: 184, E(): 3.7e-06, (53.85% identity in 52 aa overlap); and CAC48797|SMB20411 CONSERVED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) plasmid pSymB (82 aa), FASTA scores: opt: 170, E(): 4.8e-05, (44.45% identity in 63 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2821064 | 2821483 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2559c|vapc39
MTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTFWPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Bibliography
No article yet recorded