Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible toxin VapC39. Contains PIN domain.
CommentsRv2530c, (MTCY159.26), len: 139 aa. Possible vapC39, toxin, part of toxin-antitoxin (TA) operon with Rv2530A, contains PIN domain, see Arcus et al. 2005. Highly similar to others in Mycobacterium tuberculosis e.g. O53219|Rv2494|MTV008.50 (141 aa), FASTA scores: opt: 380, E(): 3.6e-19, (48.0% identity in 125 aa overlap); and O53372|Rv3320c|MTV016.20c (142 aa), FASTA scores: opt: 286, E(): 9.3e-13, (41.35% identity in 133 aa overlap); and similar to others e.g. O07760|Rv0617|MTCY19H5.04c (133 aa), FASTA scores: opt: 158, E(): 0.00048, (39.55% identity in 129 aa overlap). Also some similarity with CAC48798|SMB20412 conserved hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) plasmid pSymB (54 aa), FASTA scores: opt: 184, E(): 3.7e-06, (53.85% identity in 52 aa overlap); and CAC48797|SMB20411 conserved hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) plasmid pSymB (82 aa), FASTA scores: opt: 170, E(): 4.8e-05, (44.45% identity in 63 aa overlap).
Functional category-
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28542672854686-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2530c|vapC39
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTFWPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL