Gene Rv2530c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible toxin VapC39. Contains PIN domain. |
| Comments | Rv2530c, (MTCY159.26), len: 139 aa. Possible vapC39, toxin, part of toxin-antitoxin (TA) operon with Rv2530A, contains PIN domain, see Arcus et al. 2005. Highly similar to others in Mycobacterium tuberculosis e.g. O53219|Rv2494|MTV008.50 (141 aa), FASTA scores: opt: 380, E(): 3.6e-19, (48.0% identity in 125 aa overlap); and O53372|Rv3320c|MTV016.20c (142 aa), FASTA scores: opt: 286, E(): 9.3e-13, (41.35% identity in 133 aa overlap); and similar to others e.g. O07760|Rv0617|MTCY19H5.04c (133 aa), FASTA scores: opt: 158, E(): 0.00048, (39.55% identity in 129 aa overlap). Also some similarity with CAC48798|SMB20412 conserved hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) plasmid pSymB (54 aa), FASTA scores: opt: 184, E(): 3.7e-06, (53.85% identity in 52 aa overlap); and CAC48797|SMB20411 conserved hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) plasmid pSymB (82 aa), FASTA scores: opt: 170, E(): 4.8e-05, (44.45% identity in 63 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2854267 | 2854686 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2530c|vapC39
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTFWPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
