Gene Mb2575
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible antitoxin vapb18 |
Comments | Mb2575, -, len: 92 aa. Equivalent to Rv2545, len: 92 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 92 aa overlap). Conserved hypothetical protein. C-terminus highly similar to O33300|Rv2758c|MTV002.23c PROTEIN from Mycobacterium tuberculosis (88 aa), FASTA scores: opt: 151, E(): 9.8e-05, (66.65% identity in 45 aa overlap); and Q10771|Rv1560|MT1611|MTCY48.05 PROTEIN from Mycobacterium tuberculosis (72 aa), FASTA scores: opt: 84, E(): 8.2,(46.5% identity in 43 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2835236 | 2835514 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2575|vapb18 MSTTIVAGVIQGHLPVILPTRRRARDLGHTTALFRAQTLQCIYLSIEYLYVCSMSRRTTIDIDDILLARAQAALGTTGLKDRVDAALRAAVR
Bibliography
No article yet recorded