Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible antitoxin VapB18
CommentsRv2545, (MTY159.11c), len: 92 aa. Possible vapB18, antitoxin, part of toxin-antitoxin (TA) operon with Rv2546 (See Arcus et al., 2005; Pandey and Gerdes, 2005). Similar to others in Mycobacterium tuberculosis e.g. O33300|Rv2758c|MTV002.23c (88 aa), FASTA scores: opt: 151, E(): 9.8e-05, (66.65% identity in 45 aa overlap); and Q10771|Rv1560|MT1611|MTCY48.05 (72 aa), FASTA scores: opt: 84, E(): 8.2, (46.5% identity in 43 aa overlap).
Functional category-
TranscriptomicsmRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28677832868061+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2545|vapB18
VSTTIVAGVIQGHLPVILPTRRRARDLGHTTALFRAQTLQCIYLSIEYLYVCSMSRRTTIDIDDILLARAQAALGTTGLKDRVDAALRAAVR