Gene Mb2576
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin vapc18 |
Comments | Mb2576, -, len: 137 aa. Equivalent to Rv2546, len: 137 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 137 aa overlap). Conserved hypothetical protein. Some similarity to several HYPOTHETICAL PROTEINS from Mycobacterium tuberculosis (strain H37Rv and CDC1551) e.g. P96411|Rv0229c|MTCY08D5.24c (226 aa), FASTA scores: opt: 272, E(): 1.3e-11, (39.7% identity in 136 aa overlap); O33299|Rv2757c|MTV002.22c (138 aa), FASTA scores: opt: 265, E(): 2.5e-11, (38.5% identity in 135 aa overlap); P95026|Rv2527|MTCY159.29c (133 aa), FASTA scores: opt: 206, E(): 2.6e-07, (38.0% identity in 100 aa overlap); etc. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2835607 | 2836020 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2576|vapc18 MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRELAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
Bibliography
No article yet recorded