Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible toxin VapC18
CommentsRv2546, (MTCY159.10c), len: 137 aa. Possible vapC18, toxin, part of toxin-antitoxin (TA) operon with Rv2545, contains PIN domain (See Arcus et al., 2005; Pandey and Gerdes, 2005). Similar to others in Mycobacterium tuberculosis e.g. P96411|Rv0229c|MTCY08D5.24c (226 aa), FASTA scores: opt: 272, E(): 1.3e-11, (39.7% identity in 136 aa overlap); O33299|Rv2757c|MTV002.22c (138 aa), FASTA scores: opt: 265, E(): 2.5e-11, (38.5% identity in 135 aa overlap); P95026|Rv2527|MTCY159.29c (133 aa), FASTA scores: opt: 206, E(): 2.6e-07, (38.0% identity in 100 aa overlap); etc.
Functional categoryVirulence, detoxification, adaptation
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28681542868567+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2546|vapC18
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRELAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL