Gene Mb2626
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb40 |
| Comments | Mb2626, -, len: 81 aa. Equivalent to Rv2595, len: 81 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 81 aa overlap). Conserved hypothetical protein, showing similarity with various bacterial proteins e.g. O28268|AF2011 CONSERVED HYPOTHETICAL PROTEIN from Archaeoglobus fulgidus (86 aa), FASTA scores: opt: 120, E(): 0.13, (34.35% identity in 67 aa overlap); CAC46196|SMC01176 CONSERVED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) (79 aa), FASTA scores: opt: 119, E(): 0.14, (33.35% identity in 63 aa overlap); P37554|SP5T_BACSU|SPOVT STAGE V SPORULATION PROTEIN T from Bacillus subtilis (178 aa), FASTA scores: opt: 104, E(): 2.9, (51.45% identity in 35 aa overlap); etc. Also similar to O07779|Rv0599c|MTCY19H5.23 hypothetical protein from Mycobacterium tuberculosis (78 aa), FASTA scores: opt: 160, E(): 0.00026, (35.8% identity in 81 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2892949 | 2893194 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2626|vapb40
MRTTIDVAGRLVIPKRIRERLGLRGNDQVEITERDGRIEIEPAPTGVELVREGSVLVARPERPLPPLTDEIVRETLDRTRR
Bibliography
No article yet recorded
