Gene Rv2595
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB40 |
| Comments | Rv2595, (MTCY227.06c), len: 81 aa. Possible vapB40, antitoxin, part of toxin-antitoxin (TA) operon with Rv2596, see Arcus et al. 2005. Similarity with various bacterial proteins e.g. O28268|AF2011 conserved hypothetical protein from Archaeoglobus fulgidus (86 aa), FASTA scores: opt: 120, E(): 0.13, (34.35% identity in 67 aa overlap); CAC46196|SMC01176 conserved hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) (79 aa), FASTA scores: opt: 119, E(): 0.14, (33.35% identity in 63 aa overlap); P37554|SP5T_BACSU|SPOVT stage V sporulation protein T from Bacillus subtilis (178 aa), FASTA scores: opt: 104, E(): 2.9, (51.45% identity in 35 aa overlap); etc. Also similar to O07779|Rv0599c|MTCY19H5.23 hypothetical protein from Mycobacterium tuberculosis (78 aa), FASTA scores: opt: 160, E(): 0.00026, (35.8% identity in 81 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2925492 | 2925737 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2595|vapB40
MRTTIDVAGRLVIPKRIRERLGLRGNDQVEITERDGRIEIEPAPTGVELVREGSVLVARPERPLPPLTDEIVRETLDRTRR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
