Gene Mb2654c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE TRANSCRIPTIONAL REGULATORY PROTEIN |
| Comments | Mb2654c, -, len: 223 aa. Equivalent to Rv2621c,len: 224 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 224 aa overlap). Possible transcriptional regulator, similar in part to Q49688|MLCL536.29c|ML0592 PUTATIVE DNA-BINDING PROTEIN from Mycobacterium leprae (254 aa), FASTA scores: opt: 168, E(): 0.0018, (29.75% identity in 222 aa overlap). Shows similarity with Q9XAD0|SCC22.08c PUTATIVE DNA-BINDING PROTEIN from Streptomyces coelicolor (252 aa),FASTA scores: opt: 148, E(): 0.032, (29.4% identity in 204 aa overlap); and Q9RVM8|DR0999 CONSERVED HYPOTHETICAL PROTEIN from Deinococcus radiodurans (225 aa), FASTA scores: opt: 195, E(): 3.3e-05, (29.6% identity in 213 aa overlap). Also some similarity with O06195|Rv2618|MTCY01A10.15c from Mycobacterium tuberculosis (225 aa), FASTA scores: opt: 149, E(): 0.025,(28.95% identity in 197 aa overlap). Contains helix-turn-helix motif at aa 31-52 (Score 1662, +4.85 SD). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a 3 bp deletion (ggg-*) leads to a slightly shorter product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (223 aa versus 224 aa). |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2915350 | 2916021 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2654c|Mb2654c
MGVSVIIRSLQEPVGRRRAVLRALCASRVPMSIAAIAGKLGVHPNTVRFHLDNLVADGQVERVEPGRGRPGRPPLMFRAVRRTDSTGTRRYRLLAEILASGLAAERDSRAMALSAGRAWGRQLEAPPAGADTEETIDHLVAVLDDLGFAPERRASNGRQQVGLRHCPFLELAETQAGVVCPVHLGIMRGALQTWAPVTVDRLDAFVEPDLCLAHFTPLEGAIR
Bibliography
No article yet recorded