Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCould be involved in transcriptional mechanism.
ProductPossible transcriptional regulatory protein
CommentsRv2621c, (MTCY01A10.11), len: 224 aa. Possible transcriptional regulator, similar in part to Q49688|MLCL536.29c|ML0592 putative DNA-binding protein from Mycobacterium leprae (254 aa), FASTA scores: opt: 168, E(): 0.0018, (29.75% identity in 222 aa overlap). Shows similarity with Q9XAD0|SCC22.08c putative DNA-binding protein from Streptomyces coelicolor (252 aa), FASTA scores: opt: 148, E(): 0.032, (29.4% identity in 204 aa overlap); and Q9RVM8|DR0999 conserved hypothetical protein from Deinococcus radiodurans (225 aa), FASTA scores: opt: 195, E(): 3.3e-05, (29.6% identity in 213 aa overlap). Also some similarity with O06195|Rv2618|MTCY01A10.15c from Mycobacterium tuberculosis (225 aa), FASTA scores: opt: 149, E(): 0.025, (28.95% identity in 197 aa overlap). Contains helix-turn-helix motif at aa 31-52 (Score 1662, +4.85 SD).
Functional categoryRegulatory proteins
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29478842948558-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2621c|Rv2621c
MGVSVIIRSLQEPVGRRRAVLRALCASRVPMSIAAIAGKLGVHPNTVRFHLDNLVADGQVERVEPGRGRPGRPPLMFRAVRRTDSTGTRRYRLLAEILASGLAAERDSRAMALSAGRAWGRQLEAPPAGADTEETIDHLVAVLDDLGFAPERRASNGRQQVGLRHCPFLELAETQAGVVCPVHLGIMRGALQTWGAPVTVDRLDAFVEPDLCLAHFTPLEGAIR