Gene Mb2705c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | antibiotic-transport integral membrane leucine and alanine and valine rich protein abc transporter |
| Comments | Mb2705c, -, len: 252 aa. Equivalent to Rv2686c,len: 252 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 252 aa overlap). Probable antibiotic-transport integral membrane leu-, ala-,val-rich protein ABC transporter (see citation below). The region from aa ~115 to 160 is highly similar to N-terminus of Q49998|U1764P HYPOTHETICAL PROTEIN from Mycobacterium leprae (53 aa), FASTA scores: opt: 151, E(): 0.011,(58.15% identity in 43 aa overlap). Shows some similarity with membrane proteins e.g. AAK75541|SP1447 MEMBRANE PROTEIN from Streptococcus pneumoniae (298 aa), FASTA scores: opt: 139, E(): 0.21, (29.65% identity in 135 aa overlap); Q9K4C9|2SC6G5.26c PUTATIVE ABC TRANSPORTER INTEGRAL MEMBRANE SUBUNIT from Streptomyces coelicolor (249 aa), FASTA scores: opt: 138, E(): 0.21, (26.9% identity in 253 aa overlap); Q53627|MTRB MEMBRANE PROTEIN INVOLVED IN MITHRAMYCIN RESISTANCE from Streptomyces argillaceus (233 aa), FASTA scores: opt: 136, E(): 0.27,(26.7% identity in 191 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2959916 | 2960674 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2705c|Mb2705c
MRAISSLAGPRALAAFGRNDIRGTYRDPLLVMLVIAPVIWTTGVALLTPLFTEMLARRYGFDLVGYYPLILTAFLLLTSIIVAGALAAFLVLDDVDAGTMTALRVTPVPLSVFFGYRAATVMVVTTIYVVATMSCSGILEPGLVSSLIPIGLVAGLSAVVTLLLILAVANNKIQGLAMVRALGMLIAGLPCLPWFISSNWNLAFGVLPPYWAAKAFWVASDHGTWWPYLVGGAVYNLAIVWVLFRRFRAKHA
Bibliography
No article yet recorded