Gene Rv2686c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of unidentified antibiotic across the membrane (export): antibiotic resistance by an export mechanism. Responsible for the translocation of the substrate across the membrane. |
| Product | Antibiotic-transport integral membrane leucine and alanine and valine rich protein ABC transporter |
| Comments | Rv2686c, (MTCY05A6.07c), len: 252 aa. Antibiotic-transport integral membrane leu-, ala-, val-rich protein ABC transporter (see citation below). The region from aa ~115 to 160 is highly similar to N-terminus of Q49998|U1764P hypothetical protein from Mycobacterium leprae (53 aa), FASTA scores: opt: 151, E(): 0.011, (58.15% identity in 43 aa overlap). Shows some similarity with membrane proteins e.g. AAK75541|SP1447 membrane protein from Streptococcus pneumoniae (298 aa), FASTA scores: opt: 139, E(): 0.21, (29.65% identity in 135 aa overlap); Q9K4C9|2SC6G5.26c putative ABC transporter integral membrane subunit from Streptomyces coelicolor (249 aa), FASTA scores: opt: 138, E(): 0.21, (26.9% identity in 253 aa overlap); Q53627|MTRB membrane protein involved in mithramycin resistance from Streptomyces argillaceus (233 aa), FASTA scores: opt: 136, E(): 0.27, (26.7% identity in 191 aa overlap); etc. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3003280 | 3004038 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2686c|Rv2686c
VRAISSLAGPRALAAFGRNDIRGTYRDPLLVMLVIAPVIWTTGVALLTPLFTEMLARRYGFDLVGYYPLILTAFLLLTSIIVAGALAAFLVLDDVDAGTMTALRVTPVPLSVFFGYRAATVMVVTTIYVVATMSCSGILEPGLVSSLIPIGLVAGLSAVVTLLLILAVANNKIQGLAMVRALGMLIAGLPCLPWFISSNWNLAFGVLPPYWAAKAFWVASDHGTWWPYLVGGAVYNLAIVWVLFRRFRAKHA
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
