Gene Mb2706c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | antibiotic-transport integral membrane leucine and valine rich protein abc transporter |
| Comments | Mb2706c, -, len: 237 aa. Equivalent to Rv2687c,len: 237 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 237 aa overlap). Probable antibiotic-transport integral membrane leu-, val-rich protein ABC transporter (see citation below), showing some similarity with two other hypothetical proteins,BAB59668|TVG0517148 from Thermoplasma volcanium (241 aa),FASTA scores: opt: 136, E(): 0.32, (23.1% identity in 208 aa overlap); and Q97U55|SSO3168 from Sulfolobus solfataricus (249 aa), FASTA scores: opt: 136, E(): 0.33,(25.15% identity in 195 aa overlap). Has some hydrophobic stretches and contains bacterial regulatory proteins, araC family signature (PS00041). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2960671 | 2961384 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2706c|Mb2706c
MTRLVPALRLELTLQVRQKFLHAAVFSGLIWLAVLLPMPVSLRPVAEPYVLVGDIAIIGFFFVGGTVFFEKQERTIGAIVSTPLRFWEYLAAKLTVLLAISLFVAVVVATIVHGLGYHLLPLVAGIVLGTLLMLLVGFSSSLPFASVTDWFLAAVIPLAIMLAPPVVHYSGLWPNPVLYLIPTQGPLLLLGAAFDQVSLAPWQVGYAVVYPIVCAAGLCRAAKALFGRYVVQRSGVL
Bibliography
No article yet recorded
