Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in active transport of unidentified antibiotic across the membrane (export): antibiotic resistance by an export mechanism. Responsible for the translocation of the substrate across the membrane.
ProductAntibiotic-transport integral membrane leucine and valine rich protein ABC transporter
CommentsRv2687c, (MTCY05A6.08c), len: 237 aa. Antibiotic-transport integral membrane leu-, val-rich protein ABC transporter (see citation below), showing some similarity with two other hypothetical proteins, BAB59668|TVG0517148 from Thermoplasma volcanium (241 aa), FASTA scores: opt: 136, E(): 0.32, (23.1% identity in 208 aa overlap); and Q97U55|SSO3168 from Sulfolobus solfataricus (249 aa), FASTA scores: opt: 136, E(): 0.33, (25.15% identity in 195 aa overlap). Has some hydrophobic stretches and contains bacterial regulatory proteins, araC family signature (PS00041).
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30040353004748-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2687c|Rv2687c
MTRLVPALRLELTLQVRQKFLHAAVFSGLIWLAVLLPMPVSLRPVAEPYVLVGDIAIIGFFFVGGTVFFEKQERTIGAIVSTPLRFWEYLAAKLTVLLAISLFVAVVVATIVHGLGYHLLPLVAGIVLGTLLMLLVGFSSSLPFASVTDWFLAAVIPLAIMLAPPVVHYSGLWPNPVLYLIPTQGPLLLLGAAFDQVSLAPWQVGYAVVYPIVCAAGLCRAAKALFGRYVVQRSGVL