Gene Mb2716c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable deoxyuridine 5'-triphosphate nucleotidohydrolase dut (dutpase) (dutp pyrophosphatase) (deoxyuridine 5'-triphosphatase) (dutp diphosphatase) (deoxyuridine-triphosphatase) |
| Comments | Mb2716c, dut, len: 154 aa. Equivalent to Rv2697c,len: 154 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 154 aa overlap). Probable dut,deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23), equivalent to Q49992|DUT_MYCLE|ML1028 DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE from Mycobacterium leprae (154 aa), FASTA scores: opt: 928,E(): 2.1e-51, (90.25% identity in 154 aa overlap). Also highly similar to others e.g. O54134|DUT_STRCO|SC2E9.09 from Streptomyces coelicolor (183 aa), FASTA scores: opt: 534, E(): 1.2e-26, (56.1% identity in 148 aa overlap); O66592|DUT_AQUAE|AQ_220 from Aquifex aeolicus (150 aa),FASTA scores: opt: 398, E(): 3.3e-18, (48.05% identity in 152 aa overlap); Q9X3X5|DUT_ZYMMO from Zymomonas mobilis (146 aa), FASTA scores: opt: 396, E(): 4.4e-18, (49.0% identity in 147 aa overlap); etc. BELONGS TO THE DUTPASE FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2970319 | 2970783 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2716c|dut
MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL
Bibliography
No article yet recorded
