Gene Mb2723
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2723, -, len: 142 aa. Equivalent to Rv2704, len: 142 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 142 aa overlap). Conserved hypothetical protein, highly similar (but shorter 25 aa) to Q9RYB7|DR0033 CONSERVED HYPOTHETICAL PROTEIN from Deinococcus radiodurans (157 aa), FASTA scores: opt: 381,E(): 1.5e-17, (54.85% identity in 124 aa overlap); and highly similar to various proteins e.g. CAC47758|SMC03796 CONSERVED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) (126 aa), FASTA scores: opt: 302,E(): 1.4e-12, (46.6% identity in 126 aa overlap); Q98E55|MLL4402 from Rhizobium loti (Mesorhizobium loti) (130 aa), FASTA scores: opt: 252, E(): 2.1e-09, (40.15% identity in 127 aa overlap); Q9K3V5|SCD10.21 PUTATIVE ACETYLTRANSFERASE from Streptomyces coelicolor (291 aa),FASTA scores: opt: 247, E(): 8.7e-09, (41.3% identity in 138 aa overlap) (homology only in N-terminal region); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2976094 | 2976522 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2723|Mb2723
MSASRTMVSSGSEFESAVGYSRAVRIGPLVVVAGTTGSGDDIAAQTRDALRRIEIALGQAGATLADVVRTRIYVTDISRWREVGEVHAQAFGKIRPVTSMVEVTALIAPGLLVEIEADAYVGSAVADRNSGAGPKDPSPAGG
Bibliography
No article yet recorded
