Gene Rv2704
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv2704, (MTCY05A6.25), len: 142 aa. Conserved protein, highly similar (but shorter 25 aa) to Q9RYB7|DR0033 conserved hypothetical protein from Deinococcus radiodurans (157 aa), FASTA scores: opt: 381, E(): 1.5e-17, (54.85% identity in 124 aa overlap); and highly similar to various proteins e.g. CAC47758|SMC03796 conserved hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) (126 aa), FASTA scores: opt: 302, E(): 1.4e-12, (46.6% identity in 126 aa overlap); Q98E55|MLL4402 from Rhizobium loti (Mesorhizobium loti) (130 aa), FASTA scores: opt: 252, E(): 2.1e-09, (40.15% identity in 127 aa overlap); Q9K3V5|SCD10.21 putative acetyltransferase from Streptomyces coelicolor (291 aa), FASTA scores: opt: 247, E(): 8.7e-09, (41.3% identity in 138 aa overlap) (homology only in N-terminal region); etc. Belongs to the YJGF/YER057C/UK114 protein family. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3019458 | 3019886 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2704|Rv2704
MSASRTMVSSGSEFESAVGYSRAVRIGPLVVVAGTTGSGDDIAAQTRDALRRIEIALGQAGATLADVVRTRIYVTDISRWREVGEVHAQAFGKIRPVTSMVEVTALIAPGLLVEIEADAYVGSAVADRNSGAGPKDPSPAGG
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Thakur KG et al. [2010]. Mycobacterium tuberculosis Rv2704 is a member of the YjgF/YER057c/UK114 family. Structure
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant