Gene Mb2737c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable transcriptional regulatory protein nrdr |
| Comments | Mb2737c, -, len: 154 aa. Equivalent to Rv2718c,len: 154 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 154 aa overlap). Conserved hypothetical protein, equivalent to Q49844|ML1005|U2235A|B2235_C2_209 HYPOTHETICAL 17.3 KDA PROTEIN from Mycobacterium leprae (154 aa), FASTA scores: opt: 937, E(): 1.5e-52, (92.7% identity in 151 aa overlap). Highly similar to O86848|NRDR_STRCL PUTATIVE REGULATORY PROTEIN from Streptomyces clavuligerus (172 aa), FASTA scores: opt: 750, E(): 1.1e-40, (73.65% identity in 148 aa overlap); O69980|SC4H2.25 HYPOTHETICAL PROTEIN from Streptomyces coelicolor (182 aa), FASTA scores: opt: 725, E(): 4.6e-39, (73.1% identity in 145 aa overlap); Q9KPU0|VC2272 HYPOTHETICAL PROTEIN from Vibrio cholerae (156 aa), FASTA scores: opt: 462, E(): 1.8e-22,(47.3% identity in 148 aa overlap); etc. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2987049 | 2987513 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2737c|nrdr
MHCPFCRHPDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETAVLAVVKRSGVTEPFSREKVISGVRRACQGRQVDDDALNLLAQQVEDSVRAAGSPEIPSHDVGLAILGPLRELDEVAYLRFASVYRSFSSADDFAREIEALRAHRNLSAHS
Bibliography
No article yet recorded
