Gene Mb2747c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved alanine rich protein |
| Comments | Mb2747c, -, len: 231 aa. Equivalent to Rv2728c,len: 231 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 231 aa overlap). Conserved hypothetical ala-rich protein, equivalent to Q49835|ML0994|B2235_C1_162 HYPOTHETICAL PROTEIN from Mycobacterium leprae (232 aa), FASTA scores: opt: 1037,E(): 1.2e-54, (68.55% identity in 232 aa overlap). Also similar to O69964|SC4H2.09 from Streptomyces coelicolor (237 aa), FASTA scores: opt: 300, E(): 7.7e-11, (32.8% identity in 241 aa overlap); and some similarity with other proteins e.g. Q14234|ELN ELASTIN from Homo sapiens (Human) (757 aa), FASTA scores: opt: 161, E(): 0.03,(30.6% identity in 242 aa overlap); P55488|Y4IE HYPOTHETICAL 15.4 KDA PROTEIN from Rhizobium sp. strain NGR234 (135 aa), FASTA scores: opt: 147, E(): 0.061,(34.95% identity in 123 aa overlap). Shows also some similarity with P71657|Rv1387|MTCY21B4.04 HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (539 aa), FASTA scores: opt: 159, E(): 0.035, (34.8% identity in 135 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2997402 | 2998097 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2747c|Mb2747c
MLSAIGIVPSAPVLVPELAGAAAAELADLGAAVIAAASLLPKSWIAVGTGRADDVVRPTDVGTFAGFGADVRVGLAPQDGDGVAVPVELPLCALLTAWVRGQARPEARAQVHVYASDHGSDAAVARGRQLRADIDREPDPIGVLVVADGLNTLTPRAPGGYDPDGAGMQRALDDALASGDLAVLTRLPAQVLGRVAFQVLAGLAEPGPRSAKEFYRGAPHGVGYFAGVWQP
Bibliography
No article yet recorded
