Gene Rv2728c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved alanine rich protein |
| Comments | Rv2728c, (MTCY154.08c), len: 231 aa. Conserved ala-rich protein, equivalent to Q49835|ML0994|B2235_C1_162 hypothetical protein from Mycobacterium leprae (232 aa), FASTA scores: opt: 1037, E(): 1.2e-54, (68.55% identity in 232 aa overlap). Also similar to O69964|SC4H2.09 from Streptomyces coelicolor (237 aa), FASTA scores: opt: 300, E(): 7.7e-11, (32.8% identity in 241 aa overlap); and some similarity with other proteins e.g. Q14234|ELN elastin from Homo sapiens (Human) (757 aa), FASTA scores: opt: 161, E(): 0.03, (30.6% identity in 242 aa overlap); P55488|Y4IE hypothetical 15.4 KDA protein from Rhizobium sp. strain NGR234 (135 aa), FASTA scores: opt: 147, E(): 0.061, (34.95% identity in 123 aa overlap). Shows also some similarity with P71657|Rv1387|MTCY21B4.04 hypothetical protein from Mycobacterium tuberculosis (539 aa), FASTA scores: opt: 159, E(): 0.035, (34.8% identity in 135 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3040766 | 3041461 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2728c|Rv2728c
VLSAIGIVPSAPVLVPELAGAAAAELADLGAAVIAAASLLPKSWIAVGTGRADDVVRPTDVGTFAGFGADVRVGLAPQDGDGVAVPVELPLCALLTAWVRGQARPEARAQVHVYASDHGSDAAVARGRQLRADIDREPDPIGVLVVADGLNTLTPRAPGGYDPDGAGMQRALDDALASGDLAVLTRLPAQVLGRVAFQVLAGLAEPGPRSAKEFYRGAPHGVGYFAGVWQP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
