Gene Mb2755c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | REGULATORY PROTEIN RECX |
| Comments | Mb2755c, recX, len: 174 aa. Equivalent to Rv2736c,len: 174 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 174 aa overlap). Probable recX,regulatory protein (see citation below), equivalent to P37859|RECX_MYCLE|ML0988|U2235B REGULATORY PROTEIN RECX from Mycobacterium leprae (171 aa), FASTA scores: opt: 848, E(): 2e-46, (77.0% identity in 174 aa overlap); and CAA67596|RECX|P94965|RECX_MYCSM REGULATORY PROTEIN RECX from Mycobacterium smegmatis (188 aa), FASTA scores: opt: 679, E(): 8.8e-36, (66.45% identity in 164 aa overlap). Also similar (or highly similar to) others e.g. O50488|RECX_STRCO|SC4H8.09 from Streptomyces coelicolor (188 aa), FASTA scores: opt: 371, E(): 1.9e-16, (42.7% identity in 164 aa overlap); Q9LCZ3|RECX from Xanthomonas campestris pv. citri (162 aa), FASTA scores: opt: 189,E(): 4.4e-05, (32.45% identity in 151 aa overlap); P37860|RECX_PSEAE|PA3616 from Pseudomonas aeruginosa (153 aa), FASTA scores: opt: 159, E(): 0.0032, (30.65% identity in 137 aa overlap); etc. BELONGS TO THE RECX FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3005198 | 3005722 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2755c|recX
MTVSCPPPSTSEREEQARALCLRLLTARSRTRAELAGQLAKRGYPEDIGNRVLDRLAAVGLVDDTDFAEQWVQSRRANAAKSKRALAAELHAKGVDDDVITTVLGGIDAGAERGRAEKLVRARLRREVLIDDGTDEARVSRRLVAMLARRGYGQTLACEVVIAELAAERERRRV
Bibliography
No article yet recorded
