Gene Rv2736c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | May play a regulatory role possibly by interacting with RECA, the product of the upstream ORF. |
| Product | Regulatory protein RecX |
| Comments | Rv2736c, (MTV002.01c), len: 174 aa. Probable recX, regulatory protein (see citation below), equivalent to P37859|RECX_MYCLE|ML0988|U2235B regulatory protein RECX from Mycobacterium leprae (171 aa), FASTA scores: opt: 848, E(): 2e-46, (77.0% identity in 174 aa overlap); and CAA67596|RECX|P94965|RECX_MYCSM regulatory protein RECX from Mycobacterium smegmatis (188 aa), FASTA scores: opt: 679, E(): 8.8e-36, (66.45% identity in 164 aa overlap). Also similar (or highly similar to) others e.g. O50488|RECX_STRCO|SC4H8.09 from Streptomyces coelicolor (188 aa), FASTA scores: opt: 371, E(): 1.9e-16, (42.7% identity in 164 aa overlap); Q9LCZ3|RECX from Xanthomonas campestris pv. citri (162 aa), FASTA scores: opt: 189, E(): 4.4e-05, (32.45% identity in 151 aa overlap); P37860|RECX_PSEAE|PA3616 from Pseudomonas aeruginosa (153 aa), FASTA scores: opt: 159, E(): 0.0032, (30.65% identity in 137 aa overlap); etc. Belongs to the RecX family. |
| Functional category | Information pathways |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptomics | mRNA identified by RT-PCR (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3048562 | 3049086 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2736c|recX
MTVSCPPPSTSEREEQARALCLRLLTARSRTRAELAGQLAKRGYPEDIGNRVLDRLAAVGLVDDTDFAEQWVQSRRANAAKSKRALAAELHAKGVDDDVITTVLGGIDAGAERGRAEKLVRARLRREVLIDDGTDEARVSRRLVAMLARRGYGQTLACEVVIAELAAERERRRV
Bibliography
- Papavinasasundaram KG et al. [1997]. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Homolog Sequence Transcriptome
- Pagès V et al. [2003]. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. Homolog Regulation Secondary
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
