Gene Mb2764c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible conserved transmembrane alanine rich protein |
| Comments | Mb2764c, -, len: 270 aa. Equivalent to Rv2743c,len: 270 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 270 aa overlap). Possible conserved membrane ala-rich protein, equivalent to Q49833|MLCB33.04c|B2235_C1_148 UNKNOWN PROTEIN from Mycobacterium leprae (123 aa), FASTA scores: opt: 639,E(): 3.3e-31, (74.8% identity in 123 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3012994 | 3013806 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2764c|Mb2764c
MAVKAGQRRPWRSLLQRGVDTAGDLADLVAQKISVAIDPRARLLRRRRRALRWGLVFTAGCLLWGLVTALLAAWGWFTSLLVITGTIAVTQAIPATLLLLRYRWLRSEPLPVRRPASVRRLPPPGSAARPAMSALGASERGFFSLLGVMERGAMLPADEIRDLTAAANQTSAAMVATAAEVVSMERAVQCSAASRSYLVPTINAFTAQLSTGVRQYNEMVTAAAQLVSSANGAGGAGPGQQRYREELAGATDRLVAWAQAFDELGGLPRR
Bibliography
No article yet recorded