Gene Rv2743c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved transmembrane alanine rich protein |
| Comments | Rv2743c, (MTV002.08c), len: 270 aa. Possible conserved transmembrane ala-rich protein, equivalent to Q49833|MLCB33.04c|B2235_C1_148 unknown protein from Mycobacterium leprae (123 aa), FASTA scores: opt: 639, E(): 3.3e-31, (74.8% identity in 123 aa overlap). |
| Functional category | Cell wall and cell processes |
| Operon | Rv2744c and Rv2743c are co-transcribed, by RT-PCR (see Roback et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3056420 | 3057232 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2743c|Rv2743c
MAVKAGQRRPWRSLLQRGVDTAGDLADLVAQKISVAIDPRARLLRRRRRALRWGLVFTAGCLLWGLVTALLAAWGWFTSLLVITGTIAVTQAIPATLLLLRYRWLRSEPLPVRRPASVRRLPPPGSAARPAMSALGASERGFFSLLGVMERGAMLPADEIRDLTAAANQTSAAMVATAAEVVSMERAVQCSAASRSYLVPTINAFTAQLSTGVRQYNEMVTAAAQLVSSANGAGGAGPGQQRYREELAGATDRLVAWAQAFDELGGLPRR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Roback P et al. [2007]. A predicted operon map for Mycobacterium tuberculosis. Operon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
