Gene Mb2766c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | transcriptional regulatory protein clgr |
| Comments | Mb2766c, -, len: 112 aa. Equivalent to Rv2745c,len: 112 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 112 aa overlap). Possible transcriptional regulatory protein, highly similar to O86815|SC7C7.10 HYPOTHETICAL 13.6 KDA PROTEIN from Streptomyces coelicolor (126 aa), FASTA scores: opt: 300,E(): 2.4e-13, (60.45% identity in 86 aa overlap); and highly similar to other transcriptional regulators e.g. Q9X7S1|SC5H1.13c POSSIBLE DNA-BINDING PROTEIN from Streptomyces coelicolor (157 aa), FASTA scores: opt: 254,E(): 3.3e-10, (50.0% identity in 94 aa overlap) (N-terminus longer); Q9F885|POPR TRANSCRIPTIONAL REGULATOR from Streptomyces lividans (148 aa), FASTA scores: opt: 248, E(): 7.8e-10, (53.6% identity in 97 aa overlap) (N-terminus longer); Q9FCH1|2SCD46.12 PUTATIVE DNA-BINDING PROTEIN from Streptomyces coelicolor (141 aa), FASTA scores: opt: 162, E(): 0.00038, (33.0% identity in 106 aa overlap); etc. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3014767 | 3015105 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2766c|clgr
MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSSELLSAICTALQLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTKVVIAPVVSLAVA
Bibliography
No article yet recorded
