Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionTranscriptional regulator
ProductTranscriptional regulatory protein ClgR
CommentsRv2745c, (MTV002.10c), len: 112 aa. ClgR, transcriptional regulatory protein, controls protease systems and chaperones.
Functional categoryRegulatory proteins
TranscriptomicsmRNA identified by DNA microarray analysis: up-regulated at high temperatures, and up-regulated after 96h of starvation (see citations below).
OperonRv2745c and Rv2744c are co-transcribed, by RT-PCR (see Roback et al., 2007).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30581933058531-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2745c|clgR
MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSSELLSAICTALQLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTKVVIAPVVSLAVA