Gene Mb2776c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible type i restriction/modification system specificity determinant (fragment) hsds.1 (s protein) |
| Comments | Mb2776c, hsdS', len: 91 aa. Equivalent to Rv2755c,len: 91 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 91 aa overlap). Possible hsdS',fragment of type I restriction/modification system specificity determinant (S protein), similar to the N-terminus of other hsdS proteins e.g. O34140|HSDS from Klebsiella pneumoniae (439 aa), FASTA scores: opt: 303,E(): 2.1e-13, (46.65% identity in 90 aa overlap); P72419|STY|SBLI from Salmonella typhimurium (434 aa),FASTA scores: opt: 278, E(): 1.1e-11, (47.65% identity in 86 aa overlap); and Q9P9X9|XF2741 from Xylella fastidiosa (412 aa), FASTA scores: opt: 144, E(): 0.015, (31.7% identity in 82 aa overlap). Also some similarity with O33303|Rv2761c|MTV002.26c|HSDS POSSIBLE TYPE I RESTRICTION/MODIFICATION SYSTEM SPECIFICITY DETERMINANT from Mycobacterium tuberculosis (364 aa), FASTA scores: opt: 145, E(): 0.012, (29.9% identity in 87 aa overlap). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3024763 | 3025038 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2776c|hsdS'
MSDGWKTLRFGEVLELQRGHDLPAASRGSGTVPVIGSFGVTGMHDTAAYDGPGVAIGRSGAAIGTATFVAGPIWPLDTCLFVRDFKGNDPR
Bibliography
No article yet recorded
