Gene Rv2755c (hsdS')
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Implicated in restriction/modification of DNA. Component of type I restriction/modification system. It's possible that the M and S subunits together form a methyltransferase (MTASE) that methylates two adenine residues in complementary strands of bipartite DNA recognition sequence. |
| Product | Possible type I restriction/modification system specificity determinant (fragment) HsdS.1 (S protein) |
| Comments | Rv2755c, (MTV002.20c), len: 91 aa. Possible hsdS.1, fragment of type I restriction/modification system specificity determinant (S protein), similar to the N-terminus of other hsdS proteins e.g. O34140|HSDS from Klebsiella pneumoniae (439 aa), FASTA scores: opt: 303, E(): 2.1e-13, (46.65% identity in 90 aa overlap); P72419|sty|SBLI from Salmonella typhimurium (434 aa), FASTA scores: opt: 278, E(): 1.1e-11, (47.65% identity in 86 aa overlap); and Q9P9X9|XF2741 from Xylella fastidiosa (412 aa), FASTA scores: opt: 144, E(): 0.015, (31.7% identity in 82 aa overlap). Also some similarity with O33303|Rv2761c|MTV002.26c|HSDS possible type I restriction/modification system specificity determinant from Mycobacterium tuberculosis (364 aa), FASTA scores: opt: 145, E(): 0.012, (29.9% identity in 87 aa overlap). Note that previously known as hsdS'. |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3068189 | 3068464 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2755c|hsdS.1
MSDGWKTLRFGEVLELQRGHDLPAASRGSGTVPVIGSFGVTGMHDTAAYDGPGVAIGRSGAAIGTATFVAGPIWPLDTCLFVRDFKGNDPR
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant