Gene Mb2779c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible antitoxin vapb21 |
Comments | Mb2779c, -, len: 88 aa. Equivalent to Rv2758c, len: 88 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 88 aa overlap). Conserved hypothetical protein, similar to several other Mycobacterium tuberculosis hypothetical proteins e.g. P95008|Rv2545 (92 aa), FASTA scores: opt: 151, E(): 0.00028, (66.65% identity in 45 aa overlap); Q10771|YF60_MYCTU|RV1560|MT1611|MTCY48.05c (72 aa), FASTA scores: opt: 106, E(): 0.52, (39.15% identity in 46 aa overlap); O06565|Rv1113|MTCY22G8.02 (65 aa), FASTA scores: opt: 97, E(): 2.2, (33.35% identity in 69 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3027157 | 3027423 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2779c|vapb21 MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWRDGHPENTA
Bibliography
No article yet recorded