Gene Rv2758c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB21 |
| Comments | Rv2758c, (MTV002.23c), len: 88 aa. Possible vapB21, antitoxin, part of toxin-antitoxin (TA) operon with Rv2757c (See Arcus et al., 2005; Pandey and Gerdes, 2005). Similar to several others in M. tuberculosis e.g. P95008|Rv2545 (92 aa), FASTA scores: opt: 151, E(): 0.00028, (66.65% identity in 45 aa overlap); Q10771|YF60_MYCTU|RV1560|MT1611|MTCY48.05c (72 aa), FASTA scores: opt: 106, E(): 0.52, (39.15% identity in 46 aa overlap); O06565|Rv1113|MTCY22G8.02 (65 aa), FASTA scores: opt: 97, E(): 2.2, (33.35% identity in 69 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature. |
| Functional category | Virulence, detoxification, adaptation |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3070583 | 3070849 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2758c|vapB21
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWRDGHPENTA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
