Gene Mb2780c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc42. contains pin domain. |
| Comments | Mb2780c, -, len: 131 aa. Equivalent to Rv2759c,len: 131 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 131 aa overlap). Conserved hypothetical protein, highly similar to three M. tuberculosis hypothetical proteins O07769|Y609_MYCTU|Rv0609|MT0638|MTCY19H5.13c (133 aa),FASTA scores: opt: 364, E(): 5.1e-18, (49.6% identity in 131 aa overlap); P96914|Y624_MYCTU|Rv0624|MT0652|MTCY20H10.05 (131 aa),FASTA scores: opt: 324, E(): 2.9e-15, (42.85% identity in 126 aa overlap); and Q10874|YJ82_MYCTU|Rv1982c|MT2034|MTCY39.37 (139 aa), FASTA scores: opt: 271, E(): 1.4e-11, (38.6% identity in 127 aa overlap). Also similar to other hypothetical proteins from other bacteria e.g. CAC45376|SMC00900 CONSERVED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) (128 aa), FASTA scores: opt: 286,E(): 1.2e-12, (39.55% identity in 129 aa overlap); Q981I7|MLL9357 HYPOTHETICAL PROTEIN from Rhizobium loti (Mesorhizobium loti) (131 aa), FASTA scores: opt: 257,E(): 1.2e-10, (36.35% identity in 132 aa overlap); Q9AAG1|CC0639 HYPOTHETICAL PROTEIN from Caulobacter crescentus (131 aa), FASTA scores: opt: 217, E(): 6.9e-08,(33.35% identity in 132 aa overlap); etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3027449 | 3027844 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2780c|vapc42
MIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAAQAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Bibliography
No article yet recorded