Gene Rv2759c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible toxin VapC42. Contains PIN domain. |
| Comments | Rv2759c, (MTV002.24c), len: 131 aa. Possible vapC42, toxin, part of toxin-antitoxin (TA) operon with Rv2760c, contains PIN domain, see Arcus et al. 2005. Similar to others in M. tuberculosis e.g. O07769|Y609_MYCTU|Rv0609|MT0638|MTCY19H5.13c (133 aa), FASTA scores: opt: 364, E(): 5.1e-18, (49.6% identity in 131 aa overlap); P96914|Y624_MYCTU|Rv0624|MT0652|MTCY20H10.05 (131 aa), FASTA scores: opt: 324, E(): 2.9e-15, (42.85% identity in 126 aa overlap); and Q10874|YJ82_MYCTU|Rv1982c|MT2034|MTCY39.37 (139 aa), FASTA scores: opt: 271, E(): 1.4e-11, (38.6% identity in 127 aa overlap). Also similar to other hypothetical proteins from other bacteria e.g. CAC45376|SMC00900 conserved hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) (128 aa), FASTA scores: opt: 286, E(): 1.2e-12, (39.55% identity in 129 aa overlap); Q981I7|MLL9357 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (131 aa), FASTA scores: opt: 257, E(): 1.2e-10, (36.35% identity in 132 aa overlap); Q9AAG1|CC0639 hypothetical protein from Caulobacter crescentus (131 aa), FASTA scores: opt: 217, E(): 6.9e-08, (33.35% identity in 132 aa overlap); etc. |
| Functional category | - |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3070875 | 3071270 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2759c|vapC42
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAAQAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant