Gene Mb2809c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable bifunctional fad synthetase/riboflavin biosynthesis protein ribf: riboflavin kinase (flavokinase) + fmn adenylyltransferase (fad pyrophosphorylase) (fad synthetase)(fad diphosphorylase) (flavin adenine dinucleotide synthetase) |
| Comments | Mb2809c, ribF, len: 331 aa. Equivalent to Rv2786c,len: 331 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 331 aa overlap). Probable ribF, FAD synthetase/riboflavin biosynthesis protein, bifunctional enzyme (EC 2.7.1.26; 2.7.7.2), equivalent to O32968|RIBF|ML0852 RIBOFLAVIN KINASE from Mycobacterium leprae (331 aa), FASTA scores: opt: 1923, E(): 2.3e-115,(87.45% identity in 327 aa overlap). Also highly similar to many e.g. Q59263|RIBF_CORAM from Corynebacterium ammoniagenes (Brevibacterium ammoniagenes) (338 aa), FASTA scores: opt: 899, E(): 5.7e-50, (45.8% identity in 321 aa overlap); Q9Z530|SC9F2.05c from Streptomyces coelicolor (318 aa), FASTA scores: opt: 862, E(): 1.3e-47, (52.45% identity in 324 aa overlap); P08391|RIBF_ECOLI|B0025|Z0029ECS0028 from Escherichia coli strains K12 and O157:H7 (313 aa), FASTA scores: opt: 517, E(): 1.3e-25, (36.05% identity in 305 aa overlap); etc. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3050454 | 3051449 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2809c|ribF
MRRRLAIVQRWRGQDEIPTDWGRCVLTIGVFDGVHRGHAELIAHAVKAGRARGVPAVLMTFDPHPMEVVYPGSHPAQLTTLTRRAELVQDLGIEVFLVMPFTTDFMKLTPDRFIHELLVEHLHVVEVVVGENFTFGKKAAGNVDTLRRAGERFGFAVESMSLVSEHHSNETVTFSSTYIRSCVDAGDMVAAMEALGRPHRVEGVVVRGEGRGAELGFPTANVAPPMYSAIPADGVYAAWFTVLGHGPVTGTVVPGERYQAAVSVGTNPTFSGRTRTVEAFVLDTTADLYGQHVALDFVGRIRGQKKFESVRQLVAAMGADTERARDLLSTG
Bibliography
No article yet recorded