Gene Rv2786c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in FAD biosynthesis [catalytic activity 1: ATP + riboflavin = ADP + FMN] [catalytic activity 2: ATP + FMN = diphosphate + FAD]. |
| Product | Probable bifunctional FAD synthetase/riboflavin biosynthesis protein RibF: riboflavin kinase (flavokinase) + FMN adenylyltransferase (FAD pyrophosphorylase) (FAD synthetase)(FAD diphosphorylase) (flavin adenine dinucleotide synthetase) |
| Comments | Rv2786c, (MTV002.51c), len: 331 aa. Probable ribF, FAD synthetase/riboflavin biosynthesis protein, bifunctional enzyme, equivalent to O32968|RIBF|ML0852 riboflavin kinase from Mycobacterium leprae (331 aa), FASTA scores: opt: 1923, E(): 2.3e-115, (87.45% identity in 327 aa overlap). Also highly similar to many e.g. Q59263|RIBF_CORAM from Corynebacterium ammoniagenes (Brevibacterium ammoniagenes) (338 aa), FASTA scores: opt: 899, E(): 5.7e-50, (45.8% identity in 321 aa overlap); Q9Z530|SC9F2.05c from Streptomyces coelicolor (318 aa), FASTA scores: opt: 862, E(): 1.3e-47, (52.45% identity in 324 aa overlap); P08391|RIBF_ECOLI|B0025|Z0029ECS0028 from Escherichia coli strains K12 and O157:H7 (313 aa), FASTA scores: opt: 517, E(): 1.3e-25, (36.05% identity in 305 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3093905 | 3094900 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2786c|ribF
VRRRLAIVQRWRGQDEIPTDWGRCVLTIGVFDGVHRGHAELIAHAVKAGRARGVPAVLMTFDPHPMEVVYPGSHPAQLTTLTRRAELVQDLGIEVFLVMPFTTDFMKLTPDRFIHELLVEHLHVVEVVVGENFTFGKKAAGNVDTLRRAGERFGFAVESMSLVSEHHSNETVTFSSTYIRSCVDAGDMVAAMEALGRPHRVEGVVVRGEGRGAELGFPTANVAPPMYSAIPADGVYAAWFTVLGHGPVTGTVVPGERYQAAVSVGTNPTFSGRTRTVEAFVLDTTADLYGQHVALDFVGRIRGQKKFESVRQLVAAMGADTERARDLLSTG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
