Gene Mb2835
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PUTATIVE TRANSPOSASE [FIRST PART] |
| Comments | Mb2835, -, len: 226 aa. Similar to 5' end of Rv2812, len: 469 aa, from Mycobacterium tuberculosis strain H37Rv, (92.4% identity in 224 aa overlap). Putative transposase for IS1604, similar to putative transposases and hypothetical proteins e.g. Q9EZM2|PUTATIVE TRANSPOSASE from Mycobacterium paratuberculosis (395 aa), FASTA scores: opt: 329, E(): 3e-13, (27.05% identity in 362 aa overlap); CAC46499 PUTATIVE TRANSPOSASE PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) (390 aa),FASTA scores: opt: 327, E(): 3.9e-13, (30.5% identity in 367 aa overlap); etc. Contains possible helix-turn-helix motif at aa 50-71 (Score 1140, +3.07 SD). REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv2812 exists as a single gene. In Mycobacterium bovis, a frameshift due to a 2 bp deletion (tg-*) splits Rv2812 into 2 parts, Mb2835 and Mb2836. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3073370 | 3074050 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2835|Mb2835
MAVGDDEEKVRAERARAIGLFRYQLIWEAADAAHSTKQRGKMVRELASREHTDPFGRRVRISRQTIDRWIRGWRAGGFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQLGWAPDERTLQRNFHRLGLTGATTGSAPAVFGRFEAEHPNALWTGDVLHGIRIDLRKTYLFAFLDDHSRLVPGYRGPCRGHGAAGRRTAPGAGLPRRAQRGVCR
Bibliography
No article yet recorded