Gene Rv2812
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Required for the transposition of the insertion element IS1604. |
| Product | Probable transposase |
| Comments | Rv2812, (MTCY16B7.31c), len: 469 aa. Probable transposase for IS1604, similar to putative transposases and hypothetical proteins e.g. Q9EZM2|putative transposase from Mycobacterium paratuberculosis (395 aa), FASTA scores: opt: 329, E(): 3e-13, (27.05% identity in 362 aa overlap); CAC46499 putative transposase protein from Rhizobium meliloti (Sinorhizobium meliloti) (390 aa), FASTA scores: opt: 327, E(): 3.9e-13, (30.5% identity in 367 aa overlap); etc. Contains possible helix-turn-helix motif at aa 50-71 (Score 1140, +3.07 SD). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Insertion seqs and phages |
| Proteomics | Identified in the cytosol, cell wall, and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3116818 | 3118227 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2812|Rv2812
VAVGDDEEKVRAERARAIGLFRYQLIWEAADAAHSTKQRGKMVRELASREHTDPFGRRVRISRQTIDRWIRGWRAGGFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQLGWAPDERTLQRNFHRLGLTGATTGSAPAVFGRFEAEHPNALWTGDVLHGIRIDLRKTYLFAFLDDHSRLVPGYRWGHAEDTVRLAAALRPALASRGVPNAVYVDNGSPYVDAWLLRACAKLGVRLVHSTPGRPQGRGKIERFFRTVREQFLVEITGEPDVVGRHYVADLAELNRLFTAWVETVYHRSVHSETGQTPLARWSAGGPIPLPAPETLTEAFLWEEHRRVTKTATVSLHGNRYEIDPALVGRKVELVFDPFDLTRIEVRLAGAPMRRAIPYHIGRHSHPKAKPETPTAPPKPSGIDYAQLIETAHAAELARGVNYTALTGAADQIPGQLDLLTGQEAQPK
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
