Gene Mb2853c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin vapc22 |
Comments | Mb2853c, -, len: 130 aa. Equivalent to Rv2829c,len: 130 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 130 aa overlap). Conserved hypothetical protein similar to AAK65872|SMA2253 CONSERVED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) (125 aa), FASTA scores: opt: 171,E(): 7.7e-05, (34.9% identity in 129 aa overlap); and shows some similarity with other proteins e.g. Q9AH69 HYPOTHETICAL 14.7 KDA PROTEIN from Neisseria meningitidis (128 aa), FASTA scores: opt: 148, E(): 0.0031, (28.1% identity in 121 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3093191 | 3093583 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2853c|vapc22 MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSVAATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
Bibliography
No article yet recorded