Gene Rv2829c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible toxin VapC22 |
| Comments | Rv2829c, (MTCY16B7.13), len: 130 aa. Possible vapC22, toxin, part of toxin-antitoxin (TA) operon with Rv2830c, contains PIN domain (See Arcus et al., 2005; Pandey and Gerdes, 2005). Conserved hypothetical protein similar to AAK65872|SMA2253 conserved hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) (125 aa), FASTA scores: opt: 171, E(): 7.7e-05, (34.9% identity in 129 aa overlap); and shows some similarity with other proteins e.g. Q9AH69 hypothetical 14.7 KDA protein from Neisseria meningitidis (128 aa), FASTA scores: opt: 148, E(): 0.0031, (28.1% identity in 121 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3136620 | 3137012 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2829c|vapC22
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSVAATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
Bibliography
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
