Gene Mb2884c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE AMIDOTRANSFERASE |
| Comments | Mb2884c, -, len: 308 aa. Equivalent to Rv2859c,len: 308 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 308 aa overlap). Possible amidotransferase (EC 6.3.5.- or 2.-.-.-), equivalent (but longer 58 aa) to Q9CBU9|ML1573 POSSIBLE AMIDOTRANSFERASE from Mycobacterium leprae (249 aa), FASTA scores: opt: 1226, E(): 3e-64, (71.55% identity in 239 aa overlap). Also similar to other amidotransferases and hypothetical proteins, but shorter in N-terminus e.g. O88072|SCI35.37 HYPOTHETICAL 25.3 KDA PROTEIN from Streptomyces coelicolor (242 aa), FASTA scores: opt: 683, E(): 1.2e-32, (47.65% identity in 235 aa overlap); AAK79730|Q97I88|CAC1764 PREDICTED GLUTAMINE AMIDOTRANSFERASE from Clostridium acetobutylicum (241 aa), FASTA scores: opt: 458, E(): 1.6e-19, (32.95% identity in 246 aa overlap); AAK75201|Q97QV9|SP1089 GLUTAMINE AMIDOTRANSFERASE CLASS I from Streptococcus pneumoniae (229 aa), FASTA scores: opt: 431, E(): 5.6e-18, (34.75% identity in 236 aa overlap); etc. Contains three 17 aa repeats at the N-terminus very similar to those in other Mycobacterium tuberculosis proteins e.g. Q10699|YY30_MYCTU|Rv2090|MT2151|MTCY49.30 PUTATIVE 5'-3' EXONUCLEASE RV2090 (EC 3.1.11.-). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3127236 | 3128162 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2884c|Mb2884c
MDLSASRSDGGDPLRPASPRLRSPVSDGGDPLRPASPRLRSPVSDGGDPLRPASPRLRSPLGASRPVVGLTAYLEQVRTGVWDIPAGYLPADYFEGITMAGGVAVLLPPQPVDPESVGCVLDSLHALVITGGYDLDPAAYGQEPHPATDHPRPGRDAWEFALLRGALQRGMPVLGICRGTQVLNVALGGTLHQHLPDILGHSGHRAGNGVFTRLPVHTASGTRLAELIGESADVPCYHHQAIDQVGEGLVVSAVDVDGVIEALELPGDTFVLAVQWHPEKSLDDLRLFKALVDAASGYAGRQSQAEPR
Bibliography
No article yet recorded
