Gene Mb2922c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb2922c, -, len: 128 aa. Equivalent to Rv2898c,len: 128 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 128 aa overlap). Conserved hypothetical protein, highly similar to O33024|YS98_MYCLE|ML1607|MLCB250.49 HYPOTHETICAL 11.0 KDA PROTEIN from Mycobacterium leprae (96 aa), FASTA scores: opt: 318, E(): 2.3e-16, (58.35% identity in 96 aa overlap). Also similar to other hypothetical proteins e.g. O69890|YE19_STRCO|SC2E1.19 from Streptomyces coelicolor (130 aa), FASTA scores: opt: 253, E(): 1.7e-11, (39.65% identity in 121 aa overlap); Q9HVZ1|PA4424 from Pseudomonas aeruginosa (125 aa), FASTA scores: opt: 234,E(): 4.2e-10, (40.85% identity in 115 aa overlap); O86871 from Streptomyces lividans (85 aa), FASTA scores: opt: 224, E(): 1.8e-09, (46.45% identity in 84 aa overlap); etc. Equivalent to AAK47292 from Mycobacterium tuberculosis strain CDC1551 (141 aa) but shorter 13 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3164458 | 3164844 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2922c|Mb2922c
MTTLKTMTRVQLGAMGEALAVDYLTSMGLRILNRNWRCRYGELDVIACDAATRTVVFVEVKTRTGDGYGGLAHAVTERKVRRLRRLAGLWLADQEERWAAVRIDVIGVRVGPKNSGRTPELTHLQGIG
Bibliography
No article yet recorded