Gene Mb2951c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2951c, -, len: 207 aa. Equivalent to Rv2926c,len: 207 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 207 aa overlap). Conserved hypothetical protein, equivalent to O69468|ML1660|MLCB1243.14 HYPOTHETICAL 23.5 KDA PROTEIN from Mycobacterium leprae (217 aa), FASTA scores: opt: 866, E(): 1.4e-48, (67.2% identity in 192 aa overlap). Also similar in part to other hypothetical proteins e.g. Q9WXZ8 CONSERVED HYPOTHETICAL PROTEIN from Thermotoga maritima (182 aa), FASTA scores: opt: 254, E(): 3.4e-09,(31.45% identity in 143 aa overlap); Q9ZBQ9|SC7A1.14 HYPOTHETICAL 23.5 KDA PROTEIN from Streptomyces coelicolor (217 aa), FASTA scores: opt: 244, E(): 1.7e-08, (45.5% identity in 189 aa overlap); O65982 HYPOTHETICAL 26.2 KDA PROTEIN from Clostridium thermosaccharolyticum (Thermoanaerobacterium thermosaccharolyticum) (228 aa),FASTA scores: opt: 220, E(): 6.1e-07, (32.45% identity in 148 aa overlap); etc. Equivalent to AAK47323 from Mycobacterium tuberculosis strain CDC1551 (195 aa) but longer 12 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3197121 | 3197744 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2951c|Mb2951c
MDLGGVRRRISLMARQHGPTAQRHVASPMTVDIARLGRRPGAMFELHDTVHSPARIGLELIAIDQGALLDLDLRVESVSEGVLVTGTVAAPTVGECARCLSPVRGRVQVALTELFAYPDSATDETTEEDEVGRVVDETIDLEQPIIDAVGLELPFSPVCRPDCPGLCPQCGVPLASEPGHRHEQIDPRWAKLVEMLGPESDTLRGER
Bibliography
No article yet recorded
