Gene Mb2961
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | daunorubicin-dim-transport atp-binding protein abc transporter drra |
| Comments | Mb2961, drrA, len: 331 aa. Equivalent to Rv2936,len: 331 aa, from Mycobacterium tuberculosis strain H37Rv,(99.7% identity in 331 aa overlap). Probable drrA,daunorubicin-DIM-transport resistance ATP-binding protein ABC transporter, probably involved in daunorubicin resistance and phthiocerol dimycocerosate transport (see citations below), equivalent to Q49938|DRRA|ML2352|L518_F2_43|DRRA PROBABLE DAUNORUBICIN RESISTANCE ATP-BINDING PROTEIN from Mycobacterium leprae (331 aa), FASTA scores: opt: 1842, E(): 4.2e-103, (85.2% identity in 331 aa overlap). Also highly similar to others e.g. Q9XCF7 DRRA from Mycobacterium avium (315 aa), FASTA scores: opt: 1040, E(): 4.7e-55, (54.35% identity in 309 aa overlap); Q9X5J8 DAUNORUBICIN RESISTANCE PROTEIN A from Mycobacterium avium (315 aa), FASTA scores: opt: 1030,E(): 1.9e-54, (53.7% identity in 309 aa overlap); P32010|DRRA_STRPE DAUNORUBICIN RESISTANCE ATP-BINDING PROTEIN from Streptomyces peucetius (330 aa), FASTA scores: opt: 852, E(): 9e-44, (47.15% identity in 318 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop), and PS00211 ABC transporters family signature. BELONGS TO THE ATP-BINDING TRANSPORT PROTEIN FAMILY (ABC TRANSPORTERS). Note that Rv2936|drrA belongs to the transcriptional unit Rv2930|fadD26-Rv2939|papA5 (proven experimentaly). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3228787 | 3229782 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2961|drrA
MRNDDMAVVVNGVRKTYGKGKIVALDDVSFKVRRGEVIGLLGPNGAGKTTMVDILSTLTRPDAGSAIIAGYDVVSEPAGVRRSIMVTGQQVAVDDALSGEQNLVLFGRLWGLSKSAARKRAAELLEQFSLVHAGKRRVGTYSGGMRRRIDIACGLVVQPQVAFLDEPTTGLDPRSRQAIWDLVASFKKLGIATLLTTQYLEEADALSDRIILIDHGIIIAEGTANELKHRAGDTFCEIVPRDLKDLDAIVAALGSLLPEHHRAMLTPDSDRITMPAPDGIRMLVEAARRIDEARIELADIALRRPSLDDVFLAMTTDPTESLTHLVSGSAR
Bibliography
No article yet recorded
