Gene Mb2962
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | daunorubicin-dim-transport integral membrane protein abc transporter drrb |
| Comments | Mb2962, drrB, len: 289 aa. Equivalent to Rv2937,len: 289 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 289 aa overlap). Probable drrB,daunorubicin-DIM-transport integral membrane protein ABC transporter, probably involved in daunorubicin resistance and phthiocerol dimycocerosate transport (see citations below), equivalent to Q49935|DRRB|ML2351|L518_F1_9 DAUNORUBICIN RESISTANCE TRANSMEMBRANE PROTEIN from Mycobacterium leprae (288 aa), FASTA scores: opt: 1252,E(): 5.3e-72, (64.0% identity in 289 aa overlap). Also similar to others e.g. Q9XCF8 DRRB PROTEIN from Mycobacterium avium (246 aa), FASTA scores: opt: 423, E(): 1.5e-19, (30.85% identity in 243 aa overlap); Q9S6H4 DAUNORUBICIN RESISTANCE PROTEIN B from Mycobacterium avium (246 aa), FASTA scores: opt: 420, E(): 2.3e-19, (30.85% identity in 243 aa overlap); P32011|DRRB_STRPE DAUNORUBICIN RESISTANCE TRANSMEMBRANE PROTEIN from Streptomyces peucetius (283 aa), FASTA scores: opt: 242,E(): 4.7e-08, (27.85% identity in 219 aa overlap); etc. Note that Rv293|drrB belongs to the transcriptional unit Rv2930|fadD26-Rv2939|papA5 (proven experimentaly). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3229779 | 3230648 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2962|drrB
MSGPAIDASPALTFNQSSASIQQRRLSTGRQMWVLYRRFAAPSLLNGEVLTTVGAPIIFMVGFYIPFAIPWNQFVGGASSGVASNLGQYITPLVTLQAVSFAAIGSGFRAATDSLLGVNRRFQSMPMAPLTPLLARVWVAVDRCFTGLVISLVCGYVIGFRFHRGALYIVGFCLLVIAIGAVLSFAADLVGTVTRNPDAMLPLLSLPILIFGLLSIGLMPLKLFPHWIHPFVRNQPISQFVAALRALAGDTTKTASQVSWPVMAPTLTWLFAFVVILALSSTIVLARRP
Bibliography
No article yet recorded