Gene Rv2937
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Probably involved in active transport of antibiotic and phthiocerol dimycocerosate (dim) across the membrane (export). DRRA|Rv2934|MTCY19H9.04, DRRB and DRRC|Rv2938|MTCY19H9.06 may act jointly to confer daunorubicin and doxorubicin resistance by an export mechanism. Probably responsible for the translocation of the substrate across the membrane and localization of dim into the cell wall. |
| Product | Daunorubicin-dim-transport integral membrane protein ABC transporter DrrB |
| Comments | Rv2937, (MTCY19H9.05), len: 289 aa. drrB, daunorubicin-dim-transport integral membrane protein ABC transporter, probably involved in daunorubicin resistance and phthiocerol dimycocerosate transport (see citations below), equivalent to Q49935|DRRB|ML2351|L518_F1_9 daunorubicin resistance transmembrane protein from Mycobacterium leprae (288 aa), FASTA scores: opt: 1252, E(): 5.3e-72, (64.0% identity in 289 aa overlap). Also similar to others e.g. Q9XCF8 DRRB protein from Mycobacterium avium (246 aa), FASTA scores: opt: 423, E(): 1.5e-19, (30.85% identity in 243 aa overlap); Q9S6H4 daunorubicin resistance protein B from Mycobacterium avium (246 aa), FASTA scores: opt: 420, E(): 2.3e-19, (30.85% identity in 243 aa overlap); P32011|DRRB_STRPE daunorubicin resistance transmembrane protein from Streptomyces peucetius (283 aa), FASTA scores: opt: 242, E(): 4.7e-08, (27.85% identity in 219 aa overlap); etc. Note that Rv293|drrB belongs to the transcriptional unit Rv2930|fadD26-Rv2939|papA5 (proven experimentally). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002). |
| Operon | Rv2936 and Rv2937 are co-transcribed, by RT-PCR (see Roback et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). M. tuberculosis H37Rv drrB|Rv2937 transposon mutant does not produce phthiocerol dimycocerosate (PDIM) (See Waddell et al., 2005). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3273206 | 3274075 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2937|drrB
MSGPAIDASPALTFNQSSASIQQRRLSTGRQMWVLYRRFAAPSLLNGEVLTTVGAPIIFMVGFYIPFAIPWNQFVGGASSGVASNLGQYITPLVTLQAVSFAAIGSGFRAATDSLLGVNRRFQSMPMAPLTPLLARVWVAVDRCFTGLVISLVCGYVIGFRFHRGALYIVGFCLLVIAIGAVLSFAADLVGTVTRNPDAMLPLLSLPILIFGLLSIGLMPLKLFPHWIHPFVRNQPISQFVAALRALAGDTTKTASQVSWPVMAPTLTWLFAFVVILALSSTIVLARRP
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Camacho LR et al. [2001]. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. Mutant Function
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Waddell SJ, Chung GA, Gibson KJ, Everett MJ, Minnikin DE, Besra GS and Butcher PD [2005]. Inactivation of polyketide synthase and related genes results in the loss of complex lipids in Mycobacterium tuberculosis H37Rv. Mutant
- Roback P et al. [2007]. A predicted operon map for Mycobacterium tuberculosis. Operon
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant