Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionProbably involved in active transport of antibiotic and phthiocerol dimycocerosate (dim) across the membrane (export). DRRA|Rv2934|MTCY19H9.04, DRRB and DRRC|Rv2938|MTCY19H9.06 may act jointly to confer daunorubicin and doxorubicin resistance by an export mechanism. Probably responsible for the translocation of the substrate across the membrane and localization of dim into the cell wall.
ProductDaunorubicin-dim-transport integral membrane protein ABC transporter DrrB
CommentsRv2937, (MTCY19H9.05), len: 289 aa. drrB, daunorubicin-dim-transport integral membrane protein ABC transporter, probably involved in daunorubicin resistance and phthiocerol dimycocerosate transport (see citations below), equivalent to Q49935|DRRB|ML2351|L518_F1_9 daunorubicin resistance transmembrane protein from Mycobacterium leprae (288 aa), FASTA scores: opt: 1252, E(): 5.3e-72, (64.0% identity in 289 aa overlap). Also similar to others e.g. Q9XCF8 DRRB protein from Mycobacterium avium (246 aa), FASTA scores: opt: 423, E(): 1.5e-19, (30.85% identity in 243 aa overlap); Q9S6H4 daunorubicin resistance protein B from Mycobacterium avium (246 aa), FASTA scores: opt: 420, E(): 2.3e-19, (30.85% identity in 243 aa overlap); P32011|DRRB_STRPE daunorubicin resistance transmembrane protein from Streptomyces peucetius (283 aa), FASTA scores: opt: 242, E(): 4.7e-08, (27.85% identity in 219 aa overlap); etc. Note that Rv293|drrB belongs to the transcriptional unit Rv2930|fadD26-Rv2939|papA5 (proven experimentally).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002).
OperonRv2936 and Rv2937 are co-transcribed, by RT-PCR (see Roback et al., 2007).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). M. tuberculosis H37Rv drrB|Rv2937 transposon mutant does not produce phthiocerol dimycocerosate (PDIM) (See Waddell et al., 2005).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS32732063274075+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2937|drrB
MSGPAIDASPALTFNQSSASIQQRRLSTGRQMWVLYRRFAAPSLLNGEVLTTVGAPIIFMVGFYIPFAIPWNQFVGGASSGVASNLGQYITPLVTLQAVSFAAIGSGFRAATDSLLGVNRRFQSMPMAPLTPLLARVWVAVDRCFTGLVISLVCGYVIGFRFHRGALYIVGFCLLVIAIGAVLSFAADLVGTVTRNPDAMLPLLSLPILIFGLLSIGLMPLKLFPHWIHPFVRNQPISQFVAALRALAGDTTKTASQVSWPVMAPTLTWLFAFVVILALSSTIVLARRP
      
Bibliography