Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productconserved protein
CommentsMb2980, -, len: 243 aa. Equivalent to Rv2956, len: 243 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 243 aa overlap). Conserved hypothetical protein, highly similar to O86299|GSC GSC PROTEIN from Mycobacterium avium subsp. silvaticum Mycobacterium avium (240 aa), FASTA scores: opt: 1070, E(): 3.5e-63, (67.5% identity in 240 aa overlap); and O86294|GSC GSC PROTEIN from Mycobacterium paratuberculosis (240 aa), FASTA scores: opt: 1070, E(): 3.5e-63, (67.5% identity in 240 aa overlap). Also some similarity with other proteins from other organisms e.g. Q9L727 NODULATION PROTEIN NOEI from Rhizobium fredii (Sinorhizobium fredii) (241 aa), FASTA scores: opt: 205, E(): 3.5e-06, (27.25% identity in 198 aa overlap); Q9AGG1|LPEA LPEA PROTEIN from Rhizobium etli (286 aa), FASTA scores: opt: 201, E(): 7.2e-06, (28.85% identity in 208 aa overlap); P74191|SLL1173 HYPOTHETICAL 28.0 KDA PROTEIN Synechocystis sp. (strain PCC 6803) (244 aa), FASTA scores: opt: 274, E(): 1e-10, (30.65% identity in 225 aa overlap); etc. Also highly similar to others from Mycobacterium tuberculosis e.g. P71792|RV1513|MTCY277.35 HYPOTHETICAL 26.7 KDA PROTEIN (243 aa), FASTA scores: opt: 1105, E(): 1.7e-65, (70.05% identity in 237 aa overlap); etc.
Functional categoryConserved hypotheticals
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS32653563266087+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2980|Mb2980
MKSLKLARFIARSAAFEVSRRYSERDLKHQFVKQLKSRRVDVVFDVGANSGQYAAGLRRAAYKGRIVSFEPLSGPFTILESKASTDPLWDCRQHALGDSDGTVTINIAGNAGQSSSVLPMLKSHQNAFPPANYVGTQEASIHRLDSVAPEFLGMNGVAFLKVDVQGFEKQVLAGGKSTIDDHCVGMQLELSFLPLYEGGMLIPEALDLVYSLGFTLTGLLPCFIDANNGRMLQADGTFFREDD
      
Bibliography
No article yet recorded