Gene Rv2956
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv2956, (MTCY349.33c), len: 243 aa. Conserved protein, highly similar to O86299|GSC GSC protein from Mycobacterium avium subsp. silvaticum Mycobacterium avium (240 aa), FASTA scores: opt: 1070, E(): 3.5e-63, (67.5% identity in 240 aa overlap); and O86294|GSC GSC protein from Mycobacterium paratuberculosis (240 aa), FASTA scores: opt: 1070, E(): 3.5e-63, (67.5% identity in 240 aa overlap). Also some similarity with other proteins from other organisms e.g. Q9L727 nodulation protein NOEI from Rhizobium fredii (Sinorhizobium fredii) (241 aa), FASTA scores: opt: 205, E(): 3.5e-06, (27.25% identity in 198 aa overlap); Q9AGG1|LPEA LPEA protein from Rhizobium etli (286 aa), FASTA scores: opt: 201, E(): 7.2e-06, (28.85% identity in 208 aa overlap); P74191|SLL1173 hypothetical 28.0 KDA protein Synechocystis sp. (strain PCC 6803) (244 aa), FASTA scores: opt: 274, E(): 1e-10, (30.65% identity in 225 aa overlap); etc. Also highly similar to others from Mycobacterium tuberculosis e.g. P71792|RV1513|MTCY277.35 hypothetical 26.7 KDA protein (243 aa), FASTA scores: opt: 1105, E(): 1.7e-65, (70.05% identity in 237 aa overlap); etc. Predicted to be an outer membrane protein (See Song et al., 2008). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3308668 | 3309399 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2956|Rv2956
VKSLKLARFIARSAAFEVSRRYSERDLKHQFVKQLKSRRVDVVFDVGANSGQYAAGLRRAAYKGRIVSFEPLSGPFTILESKASTDPLWDCRQHALGDSDGTVTINIAGNAGQSSSVLPMLKSHQNAFPPANYVGTQEASIHRLDSVAPEFLGMNGVAFLKVDVQGFEKQVLAGGKSTIDDHCVGMQLELSFLPLYEGGMLIPEALDLVYSLGFTLTGLLPCFIDANNGRMLQADGIFFREDD
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
