Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productpossible glycosyl transferase
CommentsMb2982c, -, len: 366 aa. Similar to 5' end of Rv2958c, len: 428 aa, from Mycobacterium tuberculosis strain H37Rv, (83.3% identity in 371 aa overlap). Possible glycosyl transferase (EC 2.4.1.-), highly similar to Q9CD88|ML0128 PUTATIVE GLYCOSYL TRANSFERASE from Mycobacterium leprae (435 aa), FASTA scores: opt: 2116,E(): 5.8e-126, (75.05% identity in 417 aa overlap); and Q9CD91|ML0125 PUTATIVE GLYCOSYL TRANSFERASE from Mycobacterium leprae (438 aa), FASTA scores: opt: 2104,E(): 3.3e-125, (74.65% identity in 418 aa overlap). Also shows some similarity to variety of glycosyl transferases e.g. Q9RYI3 PUTATIVE GLYCOSYLTRANSFERASE from Deinococcus radiodurans (418 aa), FASTA scores: opt: 317, E(): 1.9e-12, (31.0% identity in 297 aa overlap); Q9S1V2 PUTATIVE GLYCOSYL TRANSFERASE from Streptomyces coelicolor (407 aa), FASTA scores: opt: 264, E(): 4.1e-09, (27.2% identity in 342 aa overlap); P72650|CRTX|SLR1125 ZEAXANTHIN GLUCOSYL TRANSFERASE from Synechocystis sp. strain PCC 6803 (419 aa), FASTA scores: opt: 251, E(): 2.8e-08, (26.8% identity in 295 aa overlap); etc. Very similar to P95130|MTCY349.25 from Mycobacterium tuberculosis (449 aa), FASTA score: opt: 2215, E(): 3.3e-132, (77.25% identity in 422 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a frameshift due to a single base insertion (*-g) leads to a shorter product with a different COOH part compared to its homolog in Mycobacterium tuberculosis strain H37Rv.
Functional category-
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS32675893268689-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2982c|Mb2982c
MEETSVAGDPGPDAGTSTAPNAAPEPVARRQRILFVGEAATLAHVVRPFVLARSLDPSRYEVHFACDPRFNKLLGPLPFPHHPIHTVPSEEVLLKIAQGRLFYNTRTLRKYIAADRKILNEIAPDVVVGDNRLSLSVSARLAGIPYIAIANAYWSPQARRRFPLPDVPWTRFFGVRPVSILYRLYRPLIFALYCLPLNWLRRKHGLSSLGWDLCRIFTDGDYTLYADVPELVPTYNLPANHRYLGPVLWSPDVKPPTWWHSLPTDRPIIYATLGSSGGKNLLQVVLNALGRFTRDGDRGHRWPEPPEERAGQRLRRGLPAGRSGCSALRRGALQRRQPDDAAGVGGRGAGDRAPQQHGPALEHGGP
      
Bibliography
No article yet recorded