Gene Mb3013
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN |
| Comments | Mb3013, -, len: 233 aa. Equivalent to Rv2989, len: 233 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 233 aa overlap). Probable transcriptional regulator (ala-rich protein), highly similar to O86533|SC1C2.33c PUTATIVE TRANSCRIPTIONAL REGULATOR from Streptomyces coelicolor (238 aa), FASTA scores: opt: 711, E(): 2.3e-38, (53.05% identity in 230 aa overlap); and similar to others e.g. Q9KND6 PUTATIVE TRANSCRIPTIONAL REGULATOR from Vibrio cholerae (244 aa),FASTA scores: opt: 232, E(): 1.2e-07, (29.75% identity in 232 aa overlap); Q9R9U0|SRPS EFFLUX PUMP REGULATOR from Pseudomonas putida (259 aa), FASTA scores: opt: 224, E(): 4.1e-07, (28.35% identity in 247 aa overlap); etc. Also similar to proteins from Mycobacterium tuberculosis e.g. O06806|Rv1773c|MTCY28.39 HYPOTHETICAL 26.6 KDA PROTEIN (248 aa), FASTA scores: opt: 239, E(): 4.4e-08, (29.85% identity in 231 aa overlap); P71977|RV1719|MTCY04C12.04 HYPOTHETICAL 27.9 KDA PROTEIN (259 aa), FASTA scores: opt: 215, E(): 1.6e-06, (31.85% identity in 223 aa overlap); etc. Equivalent to AAK47396 from Mycobacterium tuberculosis strain CDC1551 (267 aa) but shorter 34 aa. Contains possible helix-turn-helix motif at aa 25-46 (Score 1005, +2.61 SD). |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3302707 | 3303408 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3013|Mb3013
MRQHSGIGVLDKAVGVLHAVAESPCGLAELCDRTDLPRATAYRLAAALEVHRLLGRGQDGHWRLGPAITELATHVDDPLLVACAAVLPQLRDATGESVQVYRREGTSRVCVAALEPAAGLRDTVPVGARLPMTAGSGAKVLLAHTDAATQAAVLPKAVFSARALAEVCRRGWAQSVAEREPGVASVSAPVRDGRGVVIAAISVSGPIDRMGRRPGVRWAADLLSAADALTRRL
Bibliography
No article yet recorded
