Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transcriptional mechanism.
ProductProbable transcriptional regulatory protein
CommentsRv2989, (MTV012.03), len: 233 aa. Probable transcriptional regulator (ala-rich protein), highly similar to O86533|SC1C2.33c putative transcriptional regulator from Streptomyces coelicolor (238 aa), FASTA scores: opt: 711, E(): 2.3e-38, (53.05% identity in 230 aa overlap); and similar to others e.g. Q9KND6 putative transcriptional regulator from Vibrio cholerae (244 aa), FASTA scores: opt: 232, E(): 1.2e-07, (29.75% identity in 232 aa overlap); Q9R9U0|SRPS efflux pump regulator from Pseudomonas putida (259 aa), FASTA scores: opt: 224, E(): 4.1e-07, (28.35% identity in 247 aa overlap); etc. Also similar to proteins from Mycobacterium tuberculosis e.g. O06806|Rv1773c|MTCY28.39 hypothetical 26.6 KDA protein (248 aa), FASTA scores: opt: 239, E(): 4.4e-08, (29.85% identity in 231 aa overlap); P71977|RV1719|MTCY04C12.04 hypothetical 27.9 KDA protein (259 aa), FASTA scores: opt: 215, E(): 1.6e-06, (31.85% identity in 223 aa overlap); etc. Equivalent to AAK47396 from Mycobacterium tuberculosis strain CDC1551 (267 aa) but shorter 34 aa. Contains possible helix-turn-helix motif at aa 25-46 (Score 1005, +2.61 SD).
Functional categoryRegulatory proteins
ProteomicsIdentified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see Jungblut et al., 1999). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
TranscriptomicsmRNA identified by DNA microarray analysis: up-regulated at high temperatures (see Stewart et al., 2002), and down-regulated after 4h, 24h and 96h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33461473346848+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2989|Rv2989
VRQHSGIGVLDKAVGVLHAVAESPCGLAELCDRTDLPRATAYRLAAALEVHRLLGRGQDGHWRLGPAITELATHVDDPLLVACAAVLPQLRDATGESVQVYRREGTSRVCVAALEPAAGLRDTVPVGARLPMTAGSGAKVLLAHTDAATQAAVLPKAVFSARALAEVCRRGWAQSVAEREPGVASVSAPVRDGRGVVIAAISVSGPIDRMGRRPGVRWAADLLSAADALTRRL