Gene Mb3025
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE CONSERVED TRANSMEMBRANE PROTEIN |
| Comments | Mb3025, -, len: 219 aa. Equivalent to Rv3000, len: 219 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 219 aa overlap). Possible conserved transmembrane protein, similar to various membrane proteins e.g. P77307|YBBM_ECOLI|B0491 HYPOTHETICAL 28.2 KDA PROTEIN (POTENTIAL INTEGRAL MEMBRANE PROTEIN) from Escherichia coli strain K12 (259 aa), FASTA scores: opt: 292, E(): 3.1e-11, (30.25% identity in 218 aa overlap); N-terminus of Q9BJF3 PUTATIVE ABC TRANSPORTER (FRAGMENT) from Sterkiella histriomuscorum (1319 aa), FASTA scores: opt: 274, E(): 1.3e-09, (39.6% identity in 101 aa overlap); Q9C9W0|T23K23.21 PUTATIVE ABC TRANSPORTER from Arabidopsis thaliana (Mouse-ear cress) (263 aa), FASTA scores: opt: 258, E(): 4.4e-09, (30.1% identity in 196 aa overlap); P74369|YG47_SYNY3|SLR1647 HYPOTHETICAL 28.1 KDA PROTEIN (POTENTIAL INTEGRAL MEMBRANE PROTEIN) from Synechocystis sp. strain PCC 6803 (259 aa), FASTA scores: opt: 257, E(): 5.1e-09, (37.75% identity in 98 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3315227 | 3315886 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3025|Mb3025
MAVHGFLLERVSVVRDEATVLRQVSAHFPAGRCSAVRGASGSGKTTLLRLLNRLIDPTSGKVWLDGVPLTDLDVLVLRRRVGLVAQAPVVLTDAVLNEVRVGRPDLPEGRVTELLARLCLGQSAREAFLPHQRSALRTALIPAIDSTKVVGLISLPGAMSGLILAGVDPLTAIRYQIVVMYLLLAATAVAALTCARLAERALFDRAHRLVSLPAATRRA
Bibliography
No article yet recorded
